eCommerce WordPress Themes

FINANCIAL DOMAIN LIST [47,844] [2025-07-20]

39.99$

46 people are viewing this product right now
SKU: FINANCIAL-tlds Categories: Tag:

Discover the easy way to work with domains. Our domain lists collection gives you fast access to thousands of names, all neatly sorted by Top-Level Domain (TLD). Whether you need a full .ai domain list, a .com domain list, or any other TLD list, you will find every record arranged by level—second-level, third-level, and above. Each file also marks wildcard entries, so you can instantly see the difference between *.example.ai wildcards and regular domains such as example.ai.

These clear, ready-to-use domain name lists help:

> Cybersecurity teams run bulk reputation checks, threat-hunting scripts, and red-team recon.

> SEO analysts spot backlink gaps, study competitor footprints, and export fresh leads.

> Data scientists feed large datasets into models for traffic, DNS, and WHOIS statistics.

> Developers & DevOps write automation for SSL scans, subdomain discovery, or CDN mapping.

> Marketers launch hyper-targeted campaigns filtered by location, industry, or brand keywords.

Because every domain list is delivered in CSV, you can drop it straight into Python, Excel, BigQuery, or any SIEM. No extra cleaning needed—headers, UTF-8, and line endings are already standardised. File names follow the pattern tld-YYYYMMDD.csv, so version control is effortless.

Key points you get with our domains lists:

> Up-to-date: refreshed daily from zone-file sources.

> Complete: includes parked, premium, and newly registered names.

> Lightweight: zipped size under 5 MB for most TLDs.

> Documented: each list ships with a README covering field definitions, sample code, and API endpoints for live queries.

Typical workflow—download the domain list, feed it to your security scanner, export risky hosts, and push alerts to Slack in under ten minutes. Or grab the bulk domain list for multiple TLDs, merge with your CRM, and launch a drip email to tech founders in emerging markets.

Stop wasting hours scraping the web. With our domain lists, domains lists, and full domain name list library, you unlock reliable data for threat intel, marketing outreach, statistical research, and everyday IT housekeeping—all in one place, no hassle, no guesswork.

“domain”,”level”,”is_wildcard”
“www.ceg.financial”,3,0
“lancelott.financial”,2,0
“land.financial”,2,0
“precise.financial”,2,0
“precision.financial”,2,0
“www.cel.financial”,3,0
“landfinancing.ding.financial”,3,0
“prediction.financial”,2,0
“www.celebration.financial”,3,0
“www.celebrity.financial”,3,0
“*.sdm.financial”,3,1
“www.celeste.financial”,3,0
“www.celestial.financial”,3,0
“*.fancy.financial”,3,1
“cpanel.chatgpt.financial”,3,0
“cpanel.childsupportai.financial”,3,0
“www.cellana.financial”,3,0
“*.farnam.financial”,3,1
“cpanel.hkfp.co.financial”,4,0
“www.celo.financial”,3,0
“cpanel.copy.financial”,3,0
“www.center.financial”,3,0
“landmark.financial”,2,0
“cpanel.hometrust.financial”,3,0
“www.centerline.financial”,3,0
“lands.financial”,2,0
“cpanel.hoovler.financial”,3,0
“lane.financial”,2,0
“www.central.financial”,3,0
“www.centralex.financial”,3,0
“lang.financial”,2,0
“langford.financial”,2,0
“*.fb68.financial”,3,1
“*.fb88.financial”,3,1
“lanzola.financial”,2,0
“premiercu.financial”,2,0
“*.123b.financial”,3,1
“www.century.financial”,3,0
“premierprivatewealth.financial”,2,0
“www.ceo.prsone.financial”,4,0
“*.fbi.financial”,3,1
“*.fbiz.financial”,3,1
“premium.financial”,2,0
“*.fbseu.financial”,3,1
“www.cerebellum.financial”,3,0
“www.cerity.financial”,3,0
“www.ceritypartners.financial”,3,0
“www.certainty.financial”,3,0
“www.certifiedfinancialplanner-edmonton.financial”,3,0
“prepaid.financial”,2,0

Reviews

There are no reviews yet.

Be the first to review “FINANCIAL DOMAIN LIST [47,844] [2025-07-20]”

Your email address will not be published. Required fields are marked